PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.006G223100.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family Nin-like
Protein Properties Length: 382aa    MW: 43463.4 Da    PI: 5.2559
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.006G223100.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK79.82.9e-25304352452
              RWP-RK   4 eisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                         +++l+d ++yF+lpi+dAA+ L +c+Tv+K+iCR++G+ RWPhRkiks+
  Potri.006G223100.1 304 RLTLDDFRQYFHLPIEDAARRLHLCPTVVKKICRKFGMTRWPHRKIKSI 352
                         799********************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151918.098292372IPR003035RWP-RK domain
PfamPF020423.6E-23305352IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 382 aa     Download sequence    Send to blast
MADPRSVVPY HDPYDSPIDY EHLNFMNDAN PSLAGLSSDN EPTPAIPESF SGSANANANI  60
LDPNNPYEDP MAWNFYYENL RVQSHEAGPS HQNQGQSSFG PIPYAPFPNA SFPNASFPDG  120
QTSNASGRSE EIFLDGRNIA VWPPEPVPFQ CTCCQVLREI IHTDGNYTTK LEIHGRMGII  180
CHAILENRDH VKAIHPQYYM FDFCKKSLEN VKEFLQKYCD DRRQAGFIMV QDPHSFFYEA  240
LCVGYEWTDD LHFDEFHDPS PPNSDLQAGT LTGERQATNH GEGEIETERT TRSNLALQRE  300
RAGRLTLDDF RQYFHLPIED AARRLHLCPT VVKKICRKFG MTRWPHRKIK SIHRQLTDLQ  360
VLLNSNDAEE RDCEMLSRGG I*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011019796.10.0PREDICTED: uncharacterized protein LOC105122402
TrEMBLU5GEE01e-117U5GEE0_POPTR; Uncharacterized protein
STRINGPOPTR_0006s23960.11e-116(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF74782846
Representative plantOGRP1033348
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24020.16e-15NIN like protein 7